Property Summary

NCBI Gene PubMed Count 81
PubMed Score 859.50
PubTator Score 318.09

Knowledge Summary

Patent

No data available

Gene RIF (23)

AA Sequence

MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF      1 - 70
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL     71 - 140
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (82)

PMID Year Title