Property Summary

NCBI Gene PubMed Count 81
Grant Count 90
R01 Count 56
Funding $7,688,609.98
PubMed Score 853.76
PubTator Score 318.09

Knowledge Summary

Patent

No data available

Synonym

Accession P0DML2 P01243 Q0VDB1 Q14407 Choriomammotropin
Symbols PL
CSA
CS-1
CSMT
GHB3
hCS-1
hCS-A

Gene

PDB

1Z7C  

Gene RIF (23)

PMID Text
24475273 Placental lactogen is expressed but is not translated into protein in breast cancer.
24408518 These results indicate that placental lactogen induces CYP2E1 expression via PI3-kinase pathway in human hepatocytes.
23744883 Expression of placental lactogen mRNA is increased in plasma of women with placenta previa and invasive placenta.
23465880 altered expression of placenta lactogen appears not to be causal for betamethasone-induced fetal growth restriction in the human
22387044 results are consistent with a pleiotropic effect of placental hGH/CSH genes at the maternal-fetal interface relating to the regulation of fetal growth and the risk of affected maternal metabolism.
21765243 hPL-A is involved in the regulation of pancreatic beta cells activity.
21737519 Data conclude that members of the C/EBP and Ets families can differentially modulate CS-Benh and CS-Aenh activity.
20427283 Results strongly support a conformationally mediated obligate-ordered prolactin receptor binding for each of the three lactogenic hormones: prolactin, growth hormone, and placental lactogen.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233782 The human growth hormone/chorionic somatomammotropin at chromosome 17 is implicated in regulation of postnatal and intrauterine growth.
More...

AA Sequence

MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF      1 - 70
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL     71 - 140
KDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRS    141 - 210
VEGSCGF                                                                   211 - 217
//

Text Mined References (82)

PMID Year Title
26862561 2016 Curated eutherian third party data gene data sets.
26697363 2015 Third party data gene data set of eutherian growth hormone genes.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24475273 2014 Placental lactogen is expressed but is not translated into protein in breast cancer.
24408518 2014 Human placental lactogen induces CYP2E1 expression via PI 3-kinase pathway in female human hepatocytes.
23744883 2014 Increased levels of cell-free human placental lactogen mRNA at 28-32 gestational weeks in plasma of pregnant women with placenta previa and invasive placenta.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23465880 2013 Growth restricting effects of a single course of antenatal betamethasone treatment and the role of human placental lactogen.
22387044 2012 Differential placental expression profile of human Growth Hormone/Chorionic Somatomammotropin genes in pregnancies with pre-eclampsia and gestational diabetes mellitus.
21765243 Human placental lactogen (hPL-A) activates signaling pathways linked to cell survival and improves insulin secretion in human pancreatic islets.
More...