Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.83722801600164E-24
cystic fibrosis 1670 4.21628693065622E-7
ovarian cancer 8492 0.0187407587431637
interstitial cystitis 2299 0.0375287710817687

Synonym

Accession P0DMC3
Symbols ELA
tdl
Ende

Gene

AA Sequence

MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP                      1 - 54
//

Text Mined References (7)

PMID Year Title
26387754 2015 ELABELA Is an Endogenous Growth Factor that Sustains hESC Self-Renewal via the PI3K/AKT Pathway.
25639753 2015 Elabela-apelin receptor signaling pathway is functional in mammalian systems.
24407481 2014 Toddler: an embryonic signal that promotes cell movement via Apelin receptors.
24316148 2013 ELABELA: a hormone essential for heart development signals via the apelin receptor.
20153842 Expression of two novel transcripts in the mouse definitive endoderm.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.