Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 7.20941062136201E-42
Breast cancer 3099 3.08435267789262E-38
ovarian cancer 8492 5.82987546519655E-14
psoriasis 6685 2.00319991061145E-8
invasive ductal carcinoma 2950 2.47896026187557E-5
group 4 medulloblastoma 1875 1.2433984927487E-4
pediatric high grade glioma 2712 1.25656432636216E-4
osteosarcoma 7933 1.74906639348518E-4
medulloblastoma, large-cell 6234 2.537516808556E-4
ductal carcinoma in situ 1745 5.26346738700796E-4
atypical teratoid / rhabdoid tumor 4369 0.00308144197162929
pituitary cancer 1972 0.00404696880810798
glioblastoma 5572 0.00435016794885454
astrocytic glioma 2241 0.00484639687762701
ependymoma 2514 0.00586249320443515
oligodendroglioma 2849 0.00944812913386671
primitive neuroectodermal tumor 3031 0.0110616300924881
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0249077766776988

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.900 0.005
ependymoma -3.700 0.006
oligodendroglioma -3.300 0.009
osteosarcoma 2.270 0.000
atypical teratoid / rhabdoid tumor -1.600 0.003
glioblastoma 1.300 0.004
group 4 medulloblastoma -2.400 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor -1.400 0.011
intraductal papillary-mucinous carcinoma... -1.200 0.025
pediatric high grade glioma 1.200 0.000
psoriasis -1.500 0.000
breast carcinoma -1.500 0.000
Breast cancer -2.900 0.000
ductal carcinoma in situ -1.700 0.001
invasive ductal carcinoma -2.400 0.000
ovarian cancer -3.200 0.000
pituitary cancer 1.100 0.004

Synonym

Accession P0DMB2
Symbols

Gene

  Ortholog (1)

Species Source
Rat OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQS      1 - 70
PVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK                            71 - 117
//

Text Mined References (4)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.