Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.900 0.005
ependymoma -3.700 0.006
oligodendroglioma -3.300 0.009
osteosarcoma 2.270 0.000
atypical teratoid / rhabdoid tumor -1.600 0.003
glioblastoma 1.300 0.004
group 4 medulloblastoma -2.400 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor -1.400 0.011
intraductal papillary-mucinous carcinoma... -1.200 0.025
pediatric high grade glioma 1.200 0.000
psoriasis -1.500 0.000
breast carcinoma -1.500 0.000
Breast cancer -2.900 0.000
ductal carcinoma in situ -1.700 0.001
invasive ductal carcinoma -2.400 0.000
ovarian cancer -3.200 0.000
pituitary cancer 1.100 0.004

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQS      1 - 70
PVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK                            71 - 117
//

Text Mined References (4)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.