Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.900 4.8e-03
atypical teratoid / rhabdoid tumor -1.600 3.1e-03
Breast cancer -2.900 3.1e-38
breast carcinoma -1.500 7.2e-42
ductal carcinoma in situ -1.700 5.3e-04
ependymoma -3.700 5.9e-03
glioblastoma 1.300 4.4e-03
group 4 medulloblastoma -2.400 1.2e-04
intraductal papillary-mucinous carcinoma... -1.200 2.5e-02
invasive ductal carcinoma -2.400 2.5e-05
medulloblastoma, large-cell 1.700 2.5e-04
oligodendroglioma -3.300 9.4e-03
osteosarcoma 2.270 1.7e-04
ovarian cancer -3.200 5.8e-14
pediatric high grade glioma 1.200 1.3e-04
pituitary cancer 1.100 4.0e-03
primitive neuroectodermal tumor -1.400 1.1e-02
psoriasis -1.100 6.5e-24

Synonym

Accession P0DMB2
Symbols

Gene

  Ortholog (1)

Species Source Disease
Rat OMA EggNOG

Gene RIF (1)

AA Sequence

METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQS      1 - 70
PVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK                            71 - 117
//

Text Mined References (4)

PMID Year Title