Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0DM63
Symbols LCR16a9

Gene

 Compartment GO Term (0)

AA Sequence

MFCCLGYEWLSGGCTTWHSAWVINTLADHRHRGTDFGGSPWLLIITVFLRSYKFAISLCTSYLCVSFLKT      1 - 70
IFPSQNGHDGSTDVQQRARRSNRRRQEGIKIVLEDIFTLWRQVETKVRAKIRKMKVTTKVNRHDKINGKR     71 - 140
KTAKEHLRKLSMKEREHREEERQVSEAEENGKLDMKEIHTYMEMFQRAQALRRRAEDYYRCKITPSARKP    141 - 210
LCNRVRMAAVEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSIIDNSLSLKTPSECVLYPLPPSADD    211 - 280
NLKTPPECLLTPLPPSALPSADDNLKTPAECLLYPLPPSADDNLKTPPECLLTPLPPSAPPSADDNLKTP    281 - 350
PECVCSLPFHPQRMIISRN                                                       351 - 369
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
11586358 2001 Positive selection of a gene family during the emergence of humans and African apes.