Property Summary

NCBI Gene PubMed Count 1
PubMed Score 29.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.08118286926333E-11
acute quadriplegic myopathy 1157 2.55576738077316E-8
ulcerative colitis 2087 2.08159732281104E-7
lung adenocarcinoma 2714 3.60116146589436E-7
osteosarcoma 7933 1.73654415780386E-6
ovarian cancer 8492 2.20514157430107E-6
lung cancer 4473 2.71805501619215E-6
malignant mesothelioma 3163 7.45956869013817E-6
group 3 medulloblastoma 2254 9.67006844286418E-6
atypical teratoid/rhabdoid tumor 1095 1.31653707054696E-5
colon cancer 1475 3.20258182173605E-5
medulloblastoma, large-cell 6234 6.82145380430477E-5
cystic fibrosis 1670 4.56605472486567E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00446768207192995
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00469280907575458
pancreatic cancer 2300 0.0107421246084958
inflammatory breast cancer 404 0.011504421253646
primary pancreatic ductal adenocarcinoma 1271 0.0139518277626758
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0255621162291281
Endometriosis 535 0.0260634045763945

Expression

AA Sequence

MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCCA               1 - 61
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.