Property Summary

NCBI Gene PubMed Count 1
PubMed Score 29.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCCA               1 - 61
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.