Property Summary

NCBI Gene PubMed Count 1
PubMed Score 29.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.420 2.6e-08
atypical teratoid/rhabdoid tumor -1.400 1.3e-05
colon cancer -1.500 3.2e-05
cystic fibrosis 1.055 4.6e-04
Endometriosis -2.043 2.6e-02
group 3 medulloblastoma -2.000 9.7e-06
inflammatory breast cancer -1.200 1.2e-02
intraductal papillary-mucinous adenoma (... -1.700 4.7e-03
intraductal papillary-mucinous carcinoma... -1.900 2.6e-02
intraductal papillary-mucinous neoplasm ... -2.900 4.5e-03
lung adenocarcinoma -1.700 3.6e-07
lung cancer -1.100 1.3e-02
malignant mesothelioma -1.500 7.5e-06
medulloblastoma, large-cell -1.500 6.8e-05
non-small cell lung cancer -1.332 1.1e-11
osteosarcoma 1.985 1.7e-06
ovarian cancer 1.700 2.2e-06
pancreatic cancer -1.100 3.5e-06
primary pancreatic ductal adenocarcinoma -1.221 1.4e-02
ulcerative colitis -1.900 2.1e-07

AA Sequence

MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCCA               1 - 61
//

Text Mined References (2)

PMID Year Title