Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MASSHWNETTTSVYQYLGFQVQKIYPFHDNWNTACFVILLLFIFTVVSLVVLAFLYEVLDCCCCVKNKTV      1 - 70
KDLKSEPNPLRSMMDNIRKRETEVV                                                  71 - 95
//

Text Mined References (4)

PMID Year Title
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15885500 2005 Discovery of 342 putative new genes from the analysis of 5'-end-sequenced full-length-enriched cDNA human transcripts.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.