Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P0DKB6
Symbols SLC54A3

Gene

  Ortholog (1)

Species Source Disease
S.cerevisiae OMA Inparanoid

AA Sequence

MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMR      1 - 70
FAYRVQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS         71 - 136
//

Text Mined References (4)

PMID Year Title