Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 2.0e-03
atypical teratoid/rhabdoid tumor -1.200 5.1e-04
ependymoma -1.300 2.1e-08
osteosarcoma 1.141 5.2e-05

AA Sequence

MAPRAGQPGLQGLLLVAAALSQPAAPCPFQCYCFGGPKLLLRCASGAELRQPPRDVPPDARNLTIVGANL      1 - 70
TVLRAAAFAGGDGDGDQAAGVRLPLLSALRLTHNHIEVVEDGAFDGLPSLAALDLSHNPLRALGGGAFRG     71 - 140
LPALRSLQLNHALVRGGPALLAALDAALAPLAELRLLGLAGNALSRLPPAALRLARLEQLDVRLNALAGL    141 - 210
DPDELRALERDGGLPGPRLLLADNPLRCGCAARPLLAWLRNATERVPDSRRLRCAAPRALLDRPLLDLDG    211 - 280
ARLRCADSGADARGEEAEAAGPELEASYVFFGLVLALIGLIFLMVLYLNRRGIQRWMRNLREACRDQMEG    281 - 350
YHYRYEQDADPRRAPAPAAPAGSRATSPGSGL                                          351 - 382
//

Text Mined References (2)

PMID Year Title