Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DJR0
Symbols

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MTDPNKMIINLALFGMTQSGKSSAGNILLGSTDFHSSFAPCSVTTCCSLGRSCHLHSFMRRGGLEVALQV      1 - 70
QVLDTPGYPHSRLSKKYVKQEVKEALAHHFGQGGLHLALLVQRADVPFCGQEVTDPVQMIQELLGHAWMN     71 - 140
YTAILFTHAEKIEEAGLTEDKYLHEASDTLKTLLNSIQHKYVFQYKKGKSLNEQRMKILERIMEFIKENC    141 - 210
YQVLTFK                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
9847074 1998 Toward a complete human genome sequence.