Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DJR0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 GO Function (1)

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MTDPNKMIINLALFGMTQSGKSSAGNILLGSTDFHSSFAPCSVTTCCSLGRSCHLHSFMRRGGLEVALQV      1 - 70
QVLDTPGYPHSRLSKKYVKQEVKEALAHHFGQGGLHLALLVQRADVPFCGQEVTDPVQMIQELLGHAWMN     71 - 140
YTAILFTHAEKIEEAGLTEDKYLHEASDTLKTLLNSIQHKYVFQYKKGKSLNEQRMKILERIMEFIKENC    141 - 210
YQVLTFK                                                                   211 - 217
//

Text Mined References (2)

PMID Year Title