Property Summary

NCBI Gene PubMed Count 7
PubMed Score 24.74
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession P0DJJ0
Symbols SRGAP2P1

Gene

PANTHER Protein Class (2)

 GO Component (1)

AA Sequence

MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKL      1 - 70
AEHFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKWESRDHTTLSDIYLNNIIPRFVQVSEDSGRLFK     71 - 140
KSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSKLKEAEKQEEKQIGKSVKQEDRQTPCSPDST    141 - 210
ANVRIEEKHVRRSSVKKIEKMKEKHQAKYTENKLKAIKAQNEYLLALEATNASVFKYYIHDLSDLIDQCC    211 - 280
DLGYHASLNRALRTFLSAELNLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMG    281 - 350
DMASQLCAQQPVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME    351 - 420
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTVRECYGF                                   421 - 459
//

Text Mined References (9)

PMID Year Title