Property Summary

NCBI Gene PubMed Count 51
PubMed Score 32.01
PubTator Score 51.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.3e-59
Disease Target Count Z-score Confidence
Cognitive disorder 50 0.0 1.7
Disease Target Count Z-score Confidence
Amyloidosis 67 4.435 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.400 1.3e-59

Gene RIF (18)

AA Sequence

MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGA      1 - 70
WAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY                       71 - 122
//

Text Mined References (56)

PMID Year Title