Property Summary

NCBI Gene PubMed Count 233
PubMed Score 1265.80
PubTator Score 406.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 8.6e-23

Gene RIF (191)

AA Sequence

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV      1 - 70
WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY                       71 - 122
//

Text Mined References (238)

PMID Year Title