Property Summary

NCBI Gene PubMed Count 216
Grant Count 138
R01 Count 64
Funding $21,190,556.1
PubMed Score 1196.55
PubTator Score 406.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Synonym

Accession P0DJI8 P02735 P02736 P02737 Q16730 Q16834 Q16835 Q16879 Q3KRB3 Q6FG67 Q96QN0 Q9UCK9 Q9UCL0 SAA
Symbols SAA
PIG4
SAA2
TP53I4

Gene

PDB

4IP8   4IP9  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
488769 other 2 / 0 / 0 Center Based Initiative to identify novel inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): fluorescence-based cell-based quantitative PCR assay to identify inhibitors of LRH-1 target gene expression

Gene RIF (174)

PMID Text
26945629 Structure, function and SAA1 gene polymorphisms
26937641 Serum Amyloid A induces inflammation, proliferation and cell death in activated hepatic stellate cells.
26750935 Amyloid A overexpressed in renal cell carcinoma patients and can serve as a prognostic marker.
26642365 incorporation of SAA into HDL preparations reduced antiinflammatory properties but not to the same extent as HDL from AgNO3-injected mice
26300108 The SAA1 rs12218 polymorphism was significantly more prevalent in ankylosing spondylitis patients with amyloidosis.
26297794 Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26135899 Autocrine/paracrine and recombinant human SAA1 via TLR4 stimulate a proinflammatory phenotype that is both part of the early phase of osteogenic differentiation and the development of senescence.
26130702 These functional properties set SAA apart from well-characterized inflammatory factors, such as LPS and TNF-alpha, suggesting that it may play a homeostatic role during the course of inflammation.
26052716 human SAA is possibly only expressed in a subset of septic patients; SAA induces HMGB1 release via TLR4 and RAGE receptors; SAA supplementation worsens the outcome of lethal endotoxemia
26037829 HDL3 subpopulations in ST segment elevation myocardial infarction were enriched 10 times in SAA patients.
More...

AA Sequence

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV      1 - 70
WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY                       71 - 122
//

Text Mined References (221)

PMID Year Title
26945629 2016 Serum amyloid A1: Structure, function and gene polymorphism.
26937641 2016 Serum Amyloid A Induces Inflammation, Proliferation and Cell Death in Activated Hepatic Stellate Cells.
26750935 2016 Significance of amyloid A immunoexpression in the prognosis of renal cell carcinoma.
26642365 2016 Serum amyloid A impairs the antiinflammatory properties of HDL.
26300108 2015 The rate and significance of type 1/type 2 serum amyloid A protein gene polymorphisms in patients with ankylosing spondylitis and amyloidosis.
26297794 2015 Serum amyloid A1? induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26135899 2015 Acute phase serum amyloid A induces proinflammatory cytokines and mineralization via toll-like receptor 4 in mesenchymal stem cells.
26130702 2015 Emerging functions of serum amyloid A in inflammation.
26052716 2015 Serum Amyloid A Stimulates PKR Expression and HMGB1 Release Possibly through TLR4/RAGE Receptors.
26037829 2015 Defective functionality of small, dense HDL3 subpopulations in ST segment elevation myocardial infarction: Relevance of enrichment in lysophosphatidylcholine, phosphatidic acid and serum amyloid A.
More...