Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DJH9
Symbols TDRD9AS1
TDRD9-AS1

Gene

 Compartment GO Term (0)

AA Sequence

MPLFGWMKWPKNDSYKPTHYPGSDIVTKTLLRELKWHLKERERLIQEIENEQKVKKTGVDYNWLRNYQNP      1 - 70
HTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLE     71 - 140
DSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNLPYYHPSS                141 - 198
//

Text Mined References (2)

PMID Year Title
12508121 2003 The DNA sequence and analysis of human chromosome 14.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.