Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DJH9
Symbols TDRD9AS1
TDRD9-AS1

Gene

  Ortholog (10)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MPLFGWMKWPKNDSYKPTHYPGSDIVTKTLLRELKWHLKERERLIQEIENEQKVKKTGVDYNWLRNYQNP      1 - 70
HTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLE     71 - 140
DSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNLPYYHPSS                141 - 198
//

Text Mined References (2)

PMID Year Title
12508121 2003 The DNA sequence and analysis of human chromosome 14.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.