Property Summary

NCBI Gene PubMed Count 37
Grant Count 24
R01 Count 7
Funding $1,746,301.04
PubMed Score 201.80
PubTator Score 44.45

Knowledge Summary

Patent

No data available

Gene RIF (13)

PMID Text
26185016 RBMY is a novel oncofetal protein that plays a key role in attenuating glycogen synthase kinase 3beta activity, leading to aberrant activation of Wnt/beta-catenin signaling, which facilitates malignant hepatic stemness.
23567846 results imply that different alternative splicing may happen in testis cells and probably difference of RBMY function during spermatogenesis is due to the differential expression of RBMY protein isoforms.
23385816 One possible function of RBMY could be its involvement in sperm motility.
22190034 HIV-1 Vpu is identified to have a physical interaction with RNA binding motif protein, Y-linked, family 1, member A1 (RBMY1A1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21422736 investigation of role of RBMY in spermatogenesis: isolation and identification of RBMY target mRNAs in testis; RBMY binds to only transcript variant 2 of Nek10; RBMY may take part in alternative splicing of Nek10
20016065 regulates germline-specific splicing events; ectopic expression stimulated the inclusion of a testis-enriched exon
19893608 germ cell-specific RBMY and hnRNP G-T proteins were more efficient in stimulating TLE4-T incorporation than somatically expressed hnRNP G protein.
17881721 Patients with complete Sertoli cell-only syndrome (SCOS) did not exhibit RBMY1 gene expression.
17453684 Quantitative real-time PCR assays of this protein gave positive predictive values of 70 per cent for the recovery of sperm from testicular biopsy.
17318228 Using systematic evolution of ligands by exponential enrichment, we found that RNA stem-loops capped by a C(A)/(U)CAA pentaloop are high-affinity binding targets for hRBMY.
More...

AA Sequence

MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNG      1 - 70
KSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSHEGHLDDGGYTPDLK     71 - 140
MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMST    141 - 210
RHDGYATNDGNHPSCQETRDYAPPSRGYAYRDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDY    211 - 280
GHSRRDESYSRGYRNRRSSRETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYA    281 - 350
YRDYGHSSWDEHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA    351 - 420
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASIVDGGESRSEK    421 - 490
GDSSRY                                                                    491 - 496
//

Text Mined References (36)

PMID Year Title
26185016 2015 RBMY, a novel inhibitor of glycogen synthase kinase 3?, increases tumor stemness and predicts poor prognosis of hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
23567846 2013 Expression analysis of RNA-binding motif gene on Y chromosome (RBMY) protein isoforms in testis tissue and a testicular germ cell cancer-derived cell line (NT2).
23385816 2013 Cellular ontogeny of RBMY during human spermatogenesis and its role in sperm motility.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21422736 2011 Identifying mRNAs bound by human RBMY protein in the testis.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20016065 2010 Human RBMY regulates germline-specific splicing events by modulating the function of the serine/arginine-rich proteins 9G8 and Tra2-{beta}.
19893608 2009 The germ cell nuclear proteins hnRNP G-T and RBMY activate a testis-specific exon.
17881721 2007 Quantification of DDX3Y, RBMY1, DAZ and TSPY mRNAs in testes of patients with severe impairment of spermatogenesis.
More...