Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.600 3.3e-05
astrocytic glioma -1.200 2.2e-02
atypical teratoid / rhabdoid tumor -2.200 2.6e-08
ependymoma -1.800 2.7e-02
glioblastoma -1.300 5.1e-07
group 4 medulloblastoma -1.100 1.1e-04
medulloblastoma, large-cell -2.400 4.1e-06
ovarian cancer 2.000 4.7e-04
pancreatic cancer 1.200 6.3e-03
pancreatic ductal adenocarcinoma liver m... -1.960 2.9e-03
primitive neuroectodermal tumor -1.100 2.2e-03
subependymal giant cell astrocytoma -2.084 3.0e-02

AA Sequence

MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSP      1 - 70
HRIRSARQRRAPADEGHRPLT                                                      71 - 91
//

Text Mined References (4)

PMID Year Title