Property Summary

NCBI Gene PubMed Count 8
PubMed Score 12.73
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cytochrome-c Oxidase Deficiency 17 0.0 0.0
Disease Target Count
Leigh disease 100
Disease Target Count Z-score Confidence
Gas gangrene 17 3.301 1.7

Expression

Synonym

Accession P0DJ07
Symbols C19orf79

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (4)

AA Sequence

MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQ      1 - 70
QNS                                                                        71 - 73
//

Text Mined References (9)

PMID Year Title