Property Summary

NCBI Gene PubMed Count 2
Grant Count 12
R01 Count 6
Funding $2,168,440
PubMed Score 96.09
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

 GO Component (1)

Gene RIF (1)

PMID Text
21586586 NARR is ubiquitously expressed and resides in nucleoli where it colocalizes with ribosomal DNA gene clusters.

AA Sequence

MVGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTP      1 - 70
RARVILGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQG     71 - 140
ALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI                141 - 198
//

Text Mined References (3)

PMID Year Title
21586586 2011 Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).