Property Summary

NCBI Gene PubMed Count 2
PubMed Score 96.09
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.10876031845781E-23
ependymoma 2514 2.89552132753511E-10
pituitary cancer 1972 4.81254928542158E-7
ovarian cancer 8492 1.77804565041208E-6
sonic hedgehog group medulloblastoma 1482 5.71992181572262E-6
pilocytic astrocytoma 3086 6.42117076991238E-5
primary pancreatic ductal adenocarcinoma 1271 1.05619600245082E-4
ulcerative colitis 2087 1.89697919190999E-4
adrenocortical carcinoma 1427 4.97837312724598E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.93280470061678E-4
pancreatic cancer 2300 7.56859354447261E-4
atypical teratoid / rhabdoid tumor 4369 0.00860078827093069
gastric carcinoma 832 0.0168320787514706
astrocytic glioma 2241 0.0168435889766794
osteosarcoma 7933 0.0247031512624928
Disease Target Count Z-score Confidence
Low compliance bladder 11 4.004 2.0
Cervical cancer 23 3.176 1.6

Expression

  Differential Expression (15)

Synonym

Accession P0DI83
Symbols

Gene

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (1)

Gene RIF (1)

PMID Text
21586586 NARR is ubiquitously expressed and resides in nucleoli where it colocalizes with ribosomal DNA gene clusters.

AA Sequence

MVGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTP      1 - 70
RARVILGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQG     71 - 140
ALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI                141 - 198
//

Text Mined References (3)

PMID Year Title
21586586 2011 Identification and characterization of a novel ubiquitous nucleolar protein 'NARR' encoded by a gene overlapping the rab34 oncogene.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).