Property Summary

NCBI Gene PubMed Count 34
PubMed Score 102.90
PubTator Score 31.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -2.952 5.0e-04
astrocytic glioma -1.300 1.7e-02
Astrocytoma, Pilocytic 1.200 7.5e-05
atypical teratoid / rhabdoid tumor 1.700 8.6e-03
ependymoma 1.300 2.9e-10
gastric carcinoma 1.500 1.7e-02
intraductal papillary-mucinous carcinoma... -1.500 6.9e-04
lung carcinoma -1.200 1.1e-23
osteosarcoma 1.016 2.5e-02
ovarian cancer -2.000 1.1e-05
pancreatic cancer 2.100 7.6e-04
pituitary cancer -2.000 4.8e-07
primary pancreatic ductal adenocarcinoma 2.239 1.1e-04
sonic hedgehog group medulloblastoma 1.500 5.7e-06
ulcerative colitis 1.500 1.9e-04

Synonym

Accession P0DI83
Symbols RAH
NARR
RAB39

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Component (1)

Protein-protein Interaction (2)

Gene RIF (10)

AA Sequence

MVGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTP      1 - 70
RARVILGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQG     71 - 140
ALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI                141 - 198
//

Text Mined References (34)

PMID Year Title