Property Summary

NCBI Gene PubMed Count 47
PubMed Score 25.31
PubTator Score 99.60

Knowledge Summary

Patent

No data available

Synonym

Accession P0DI82 A6NEG0 O14582 Q9HD16
Symbols SEDL
SEDT
MIP2A
TRS20
ZNF547L
hYP38334
TRAPPC2P1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 IMPC Phenotype (1)

Gene RIF (25)

AA Sequence

MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEW      1 - 70
FVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS     71 - 140
//

Text Mined References (50)

PMID Year Title