Property Summary

NCBI Gene PubMed Count 47
PubMed Score 25.31
PubTator Score 99.60

Knowledge Summary

Patent

No data available

 IMPC Phenotype (1)

Gene RIF (25)

AA Sequence

MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEW      1 - 70
FVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLLS     71 - 140
//

Text Mined References (50)

PMID Year Title