Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.25176158687769E-13

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 0.000

Synonym

Accession P0DH78
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MQDAAAGGPPGLGGGGPPEERTDCIICCSAYDLSGHLPRRLYCGHTFCQACVRRLDTPAPEQRWIPCPQC      1 - 70
RQSTPTPRGGVAMLDLDLAAFLAVKAEREPARLEPLPLTSLKGSAITRQPAGLCPALGPQPHFPQPRYCC     71 - 140
WGCGSLCCPPLGSPEV                                                          141 - 156
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.