Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CZ25
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MHSLPRSGSIRRTHSDTQATGWPPPQRIGDSPGPSPAFLSCPPSLCGGAAQTGDPVALPHGPEKWVWGGG      1 - 70
LSPRNPHSWGIKAHGLRPPWAPRLERCMVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCA     71 - 140
KRGTHSCGPRESGGPDTCHLPCH                                                   141 - 163
//

Text Mined References (4)

PMID Year Title
19797681 2009 Darwinian alchemy: Human genes from noncoding DNA.
19726446 2009 Recent de novo origin of human protein-coding genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.