Knowledge Summary

Patent

No data available

AA Sequence

MMVNHNFTSFTSNERAVVKLNEVMQAALVNSDDRDWRYFVMLVPVLYDMQQFLVKEGSMNERFVAQAPKF      1 - 70
DINFWRMIITVMAINFFKWQGKDVAELMKTSSAIDDLQFKFLQVDDKDDHFNLPVIAETFRGLSPKMKPL     71 - 140
KGADSVVALEPKLTEAQIQAELEFADKRLAQFKAASVKDVVSDNVVNMLRGFHEGLATEYQATHDLWQPA    141 - 210
MFNALATDKLFNYWSPAWDNLDGIGGEVKSYLTFLSQKQDISGLSEFVTGTAGIDRYIDVAALNHLLEQM    211 - 280
PEDVLAERAL                                                                281 - 290
//

Text Mined References (3)

PMID Year Title