Knowledge Summary

Patent

No data available

AA Sequence

MMVNHNFTSFTSNERAVVKLNEVMQAALVNSDDRDWRYFVMLVPVLYDMQQFLVKEGSMNERFVAQAPKF      1 - 70
DINFWRMIITVMAINFFKWQGKDVAELMKTSSAIDDLQFKFLQVDDKDDHFNLPVIAETFRGLSPKMKPL     71 - 140
KGADSVVALEPKLTEAQIQAELEFADKRLAQFKAASVKDVVSDNVVNMLRGFHEGLATEYQATHDLWQPA    141 - 210
MFNALATDKLFNYWSPAWDNLDGIGGEVKSYLTFLSQKQDISGLSEFVTGTAGIDRYIDVAALNHLLEQM    211 - 280
PEDVLAERAL                                                                281 - 290
//

Text Mined References (3)

PMID Year Title
21383955 2011 Interactions of MCP1 with components of the replication machinery in mammalian cells.
11196133 2000 The human autoantigen MCP1 is required during early stages of DNA replication.
9543011 1998 Molecular cloning of metaphase chromosome protein 1 (MCP1), a novel human autoantigen that associates with condensed chromosomes during mitosis.