Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.100 0.000

Synonym

Accession P0CW27
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAPKKKRGPSAGSQPGGAAAAGAEQPLSERAQYLQREHALLSEQLDTCEESVDQVLRENAFLDREALRLR      1 - 70
EENRLYASYVSARAQRCAKAIVRLDEQNRVDLAQIHWQRAELASLYHGREDGVRAQLLEMEARAAQMAQQ     71 - 140
VQELQPYKVLQLEQLARIRALERELLHMRVEHTQLLHRVKRRFLEDKAAFEREARQRVQSLARRAEREAV    141 - 210
RALVAHTQAIKADNGRLRQELLLLLRRTQLLHHTRRQLLEQREQLHREHEDTRDLARVHGWLRRGPGGPP    211 - 280
LWERPAFSQPTSRPGSLAAPISPSRAASQTPSVVPSRAAPRASSVVPSREASRVPSLVLSSMDSRVPSLA    281 - 350
TSKVGSRMPSLTASRAGSRALSLVQSLEGSGISSGSSPRVSSQDTLRSTKSGPKLLSGLSRDRDPALLPP    351 - 420
QSEDSVNAEAAAEASPGRA                                                       421 - 439
//

Text Mined References (1)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.