Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.004
ependymoma -2.000 0.010
glioblastoma -2.100 0.000
oligodendroglioma -1.100 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.300 0.005
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.600 0.000
spina bifida 1.108 0.025
facioscapulohumeral dystrophy 1.400 0.001

Synonym

Accession P0CW24 A8K1G4 D3DWT8 P0CW26 Q96A40
Symbols MA6
PNMA6
PNMA6C

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELD      1 - 70
REVNYALVPREIPGTGGPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIG     71 - 140
QAVQPWVEAVRCQSLGVFSGRDQPAPGEESFEVWLDHTTEMLHVWQGVSERERRRRLLEGLRGTALQLVH    141 - 210
ALLAENPARTAQDCLAALAQVFGDNESQATIRVKCLTAQQQSGERLSAFVLRLEVLLQKAMEKEALARAS    211 - 280
ADRVRLRQMLTRAHLTEPLDEALRKLRMAGRSPSFLEMLGLVRESEAWEASLARSVRAQTQEGAGARAGA    281 - 350
QAVARASTKVEAVPGGPGREPEGLLQAGGQEAEELLQEGLKPVLEECDN                         351 - 399
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
16407312 2006 A functional -1 ribosomal frameshift signal in the human paraneoplastic Ma3 gene.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16214224 2005 The human PNMA family: novel neuronal proteins implicated in paraneoplastic neurological disease.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...