Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.08
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.300 2.8e-06
astrocytic glioma -1.500 3.6e-03
Astrocytoma, Pilocytic -1.600 1.7e-08
atypical teratoid / rhabdoid tumor -1.800 2.3e-06
ependymoma -2.000 1.0e-02
facioscapulohumeral dystrophy 1.400 1.0e-03
glioblastoma -1.500 1.7e-06
medulloblastoma -1.100 6.6e-05
medulloblastoma, large-cell -1.700 1.3e-04
oligodendroglioma -1.100 5.2e-10
primitive neuroectodermal tumor -1.300 5.3e-03
spina bifida 1.108 2.5e-02

AA Sequence

MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELD      1 - 70
REVNYALVPREIPGTGGPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIG     71 - 140
QAVQPWVEAVRCQSLGVFSGRDQPAPGEESFEVWLDHTTEMLHVWQGVSERERRRRLLEGLRGTALQLVH    141 - 210
ALLAENPARTAQDCLAALAQVFGDNESQATIRVKCLTAQQQSGERLSAFVLRLEVLLQKAMEKEALARAS    211 - 280
ADRVRLRQMLTRAHLTEPLDEALRKLRMAGRSPSFLEMLGLVRESEAWEASLARSVRAQTQEGAGARAGA    281 - 350
QAVARASTKVEAVPGGPGREPEGLLQAGGQEAEELLQEGLKPVLEECDN                         351 - 399
//

Text Mined References (17)

PMID Year Title