Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 9.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 5.1538883395937E-10
pilocytic astrocytoma 3086 3.56460641083612E-8
sonic hedgehog group medulloblastoma 1482 4.76477365020598E-7
atypical teratoid / rhabdoid tumor 4369 2.27871266778202E-6
adult high grade glioma 2148 2.75679362936106E-6
glioblastoma 5572 2.30148844487606E-5
medulloblastoma, large-cell 6234 1.30653232505898E-4
facioscapulohumeral dystrophy 286 0.00104449833973485
astrocytic glioma 2241 0.00362003723932434
primitive neuroectodermal tumor 3031 0.00525040926150632
ependymoma 2514 0.0103879335837976
spina bifida 1064 0.024645842110964

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.500 0.004
ependymoma -2.000 0.010
glioblastoma -2.100 0.000
oligodendroglioma -1.100 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.300 0.005
adult high grade glioma -2.300 0.000
pilocytic astrocytoma -1.600 0.000
spina bifida 1.108 0.025
facioscapulohumeral dystrophy 1.400 0.001

AA Sequence

MAVTMLQDWCRWMGVNARRGLLILGIPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELD      1 - 70
REVNYALVPREIPGTGGPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIG     71 - 140
QAVQPWVEAVRCQSLGVFSGRDQPAPGEESFEVWLDHTTEMLHVWQGVSERERRRRLLEGLRGTALQLVH    141 - 210
ALLAENPARTAQDCLAALAQVFGDNESQATIRVKCLTAQQQSGERLSAFVLRLEVLLQKAMEKEALARAS    211 - 280
ADRVRLRQMLTRAHLTEPLDEALRKLRMAGRSPSFLEMLGLVRESEAWEASLARSVRAQTQEGAGARAGA    281 - 350
QAVARASTKVEAVPGGPGREPEGLLQAGGQEAEELLQEGLKPVLEECDN                         351 - 399
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19366867 2009 Paraneoplastic antigen-like 5 gene (PNMA5) is preferentially expressed in the association areas in a primate specific manner.
16407312 2006 A functional -1 ribosomal frameshift signal in the human paraneoplastic Ma3 gene.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16214224 2005 The human PNMA family: novel neuronal proteins implicated in paraneoplastic neurological disease.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...