Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
25653177 These findings suggest that C18orf42 may be a novel PKA signaling gene that serves as an endogenous disruptor peptide for PKA-AKAP interactions.

AA Sequence

MVFAPGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK       1 - 69
//

Text Mined References (4)

PMID Year Title
25653177 2015 Hypothetical gene C18orf42 encodes a novel protein kinase A-binding protein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.