Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CW21
Symbols SPG20OS
C13orf43

Gene

 Compartment GO Term (0)

AA Sequence

MKDIGHLQHLAQRLQWNRRAVNICGMHGWTKDLSPHSRMPSMLEHVKHYMSC                        1 - 52
//

Text Mined References (2)

PMID Year Title
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.