Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.67
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
17435276 The full length of its cDNA was 963 bp, with a 354-bp open reading frame (ORF), encoding a 117-amino acid protein. PINCH 2 was a splicing isoform of PINCH.

AA Sequence

MAFSGRARPCIIPENEEIPRAALNTVHEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAKFNMANALASA      1 - 70
TCERCKGGFAPAETIVNSNGELYHEQCFVCAQCFQQFPEGLFYEERT                            71 - 117
//

Text Mined References (7)

PMID Year Title
17435276 2007 Molecular cloning and characterization of a novel splice variant of the LIM domain family gene, PINCH 2, in human testis.
16341674 2005 Transcriptome analysis of human gastric cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.