Property Summary

NCBI Gene PubMed Count 1
PubMed Score 88.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDI      1 - 70
MAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERR     71 - 140
RKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPY    141 - 210
FQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDL    211 - 280
WRNPLQYYKRMKPPEEGTETSGDSQLLS                                              281 - 308
//

Text Mined References (2)

PMID Year Title