Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.41
PubTator Score 0.25

Knowledge Summary

Patent

No data available

AA Sequence

MIFSMLRKLPKVTCRDVLPEIRAICIEEIGCWMQSYSTSFLTDSYLKYIGWTLHDKHREVRVKCVKALKG      1 - 70
LYGNRDLTARLELFTGCFKDWMVSMIMDREYSVAVEAVRLLILILKNMEGVLMDVDCESVYPIV           71 - 134
//

Text Mined References (6)

PMID Year Title