Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.19739232678858E-6
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0021781844061595
cystic fibrosis and chronic rhinosinusitis 213 0.0106567520077374
progressive supranuclear palsy 674 0.0169258947701234
oligodendroglioma 2849 0.0202342100403741
astrocytic glioma 2241 0.0214154852128551
Alzheimer's disease 644 0.0338343351160985

Synonym

Accession P0CL83 A6NMT8 A8K0A1 Q32NE4 Q6NXR2 Q7L5M5 Q7Z5K6
Symbols STAG3L2
STAG3L3
STAG3L1P

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MIFSMLRKLPKVTCRDVLPEIRAICIEEIGCWMQSYSTSFLTDSYLKYIGWTLHDKHREVRVKCVKALKG      1 - 70
LYGNRDLTARLELFTGRFKDWMVSMIVDREYSVAVEAVRLLILILKLFYPECEIRTMGGREQRQSPGAQR     71 - 140
TFFQLLLSFFVESKLHDHAAYLVDNLWDCAGTQLKDWEGLTSLLLEKDQSTCHMEPGPGTFHLLG         141 - 205
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10698974 2000 STAG3, a novel gene encoding a protein involved in meiotic chromosome pairing and location of STAG3-related genes flanking the Williams-Beuren syndrome deletion.
9847074 1998 Toward a complete human genome sequence.