Property Summary

NCBI Gene PubMed Count 1
PubMed Score 84.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Umbilical hernia 18 3.176 1.6

Synonym

Accession P0CL82 Q66I50 GAGE-12I
Symbols AL4
CT4.7
GAGE-12G

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (4)

PMID Year Title
20546897 2010 Expression, purification and characterization of the cancer-germline antigen GAGE12I: a candidate for cancer immunotherapy.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.