Property Summary

NCBI Gene PubMed Count 1
PubMed Score 84.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Umbilical hernia 18 3.176 1.6

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (4)

PMID Year Title
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.