Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 2.42735095429979E-4
ovarian cancer 8492 3.25254842381082E-4
Pick disease 1893 4.56491299153866E-4
posterior fossa group B ependymoma 1530 0.00160616077134098
pediatric high grade glioma 2712 0.00567496959328714
lung cancer 4473 0.0114319142730863
spina bifida 1064 0.0395569813670754

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.900 0.000
lung cancer 1.300 0.011
pediatric high grade glioma -1.200 0.006
posterior fossa group B ependymoma -1.100 0.002
spina bifida -1.741 0.040
Pick disease 1.300 0.000
ovarian cancer 1.300 0.000

Synonym

Gene

  Ortholog (1)

Species Source
Anole lizard OMA Inparanoid

AA Sequence

MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGV      1 - 70
WSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPP     71 - 140
NFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGRPSDREEREELQLQ    141 - 210
PGRGAAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLPAS                  211 - 266
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.