Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.900 0.000
lung cancer 1.300 0.011
pediatric high grade glioma -1.200 0.006
posterior fossa group B ependymoma -1.100 0.002
spina bifida -1.741 0.040
Pick disease 1.300 0.000
ovarian cancer 1.300 0.000

AA Sequence

MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGV      1 - 70
WSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPP     71 - 140
NFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGRPSDREEREELQLQ    141 - 210
PGRGAAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLPAS                  211 - 266
//

Text Mined References (5)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.