Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 6.6e-11
Pick disease 1894 2.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -2.200 6.6e-11
Pick disease -1.300 2.8e-03

Synonym

Accession P0CK96 B3KWR0 O75035 Q2TAY8 Q569F8 Q5CZA4 Q9Y3J8
Symbols SLC35E2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

AA Sequence

MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGV      1 - 70
WSSRALLYLTLWFFFSFCTLFLNKYILSLLGGEPSMLGAVQMLSTTVIGCVKTLVPCCLYQHKARLSYPP     71 - 140
NFLMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGL    141 - 210
ALCTATEISFNVLGFSAALSTNIMDCLQNVFSKKLLSGDKYRFSAPELQFYTSAAAVAMLVPARVFFTDV    211 - 280
PVIGRSGKSFSYNQDVVLLLLTDGVLFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSVIVFGNKIT    281 - 350
SLSAVGTALVTVGVLLYNKARQHQQEALQSLAAATGRAPDDTVEPLLPQDPRQHP                   351 - 405
//

Text Mined References (7)

PMID Year Title