Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Synonym

Accession P0CI26 A0AVR7 A0AVR9 Q6DJV1 Q9NS80
Symbols TRIM49L2

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MNSGILQVFQGELICPLCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHL      1 - 70
KKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQEHRYHRHRPIEWAAEEHREKL     71 - 140
LQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKEIFH    141 - 210
RLHLSKAKMAHRMEILRGMYEELNEMCHKPDVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRD    211 - 280
RLNQFRVHITLHHEEANSDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGKYYWEVHVGDS    281 - 350
WNWAFGVCNMYRKEKNQNEKIDGKEGLFLLGCIKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV    351 - 420
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452
//

Text Mined References (5)

PMID Year Title
22144910 2011 Identification of a genomic reservoir for new TRIM genes in primate genomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.