Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 3.5e-21

AA Sequence

MNSGILQVFQGELICPLCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHL      1 - 70
KKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQEHRYHRHRPIEWAAEEHREKL     71 - 140
LQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKEIFH    141 - 210
RLHLSKAKMAHRMEILRGMYEELNEMCHKPDVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRD    211 - 280
RLNQFRVHITLHHEEANSDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGKYYWEVHVGDS    281 - 350
WNWAFGVCNMYRKEKNQNEKIDGKEGLFLLGCIKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV    351 - 420
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452
//

Text Mined References (5)

PMID Year Title