Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.53
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.9e-36

 GO Component (1)

 Compartment GO Term (1)

 GWAS Trait (1)

Protein-protein Interaction (3)

AA Sequence

MNSGILQVFQGELICPLCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHL      1 - 70
KKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQEHRYHRHRPIEWAAEEHREKL     71 - 140
LQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKEIFH    141 - 210
RLHLSKAKMAHRMEILRGMYEELNEMCHKPDVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRD    211 - 280
RLNQFRVHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGKYYWEVHVGDS    281 - 350
WNWAFGVCNMYRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV    351 - 420
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452
//

Text Mined References (7)

PMID Year Title