Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MHSLEKVTFEDVAIDFTQEEWDMMDTSKRKLYRDVMLENISHLVSLGYQISKSYIILQLEQGKELWWEGR      1 - 70
VFLQDQNPDRESALKKKHMISMHPIIRKDTSTSMTMENSLILEDPFEYNDSGEDCTHSSTITQCLLTHSG     71 - 140
KKPCVSKQCGKSLRNLLSPKPRKQIHTKGKSYQCNLCEKAYTNCFYLRRHKMTHTGERPYACHLCGKAFT    141 - 210
QCSHLRRHEKTHTGERPYKCHQCGKAFIQSFNLRRHERTHLGQKCYECDKSGKAFSQSSGFRGNKIIHIG    211 - 280
EKPPACLLCGKAFSLSSDLR                                                      281 - 300
//

Text Mined References (2)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.