Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CH98
Symbols FAM106C

Gene

 Compartment GO Term (0)

AA Sequence

MLPSTMFLVHLPLSTNRLHCLRNTSLESCLCSFVHLNHPLHISDPVILISLHEAVRFSFAFSFPRGTLSI      1 - 70
AYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKEL     71 - 140
PLRNLLECRFFDCMGEEDLINLGVIGTER                                             141 - 169
//

Text Mined References (3)

PMID Year Title