Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0CH98
Symbols FAM106C

Gene

 Compartment GO Term (0)

AA Sequence

MLPSTMFLVHLPLSTNRLHCLRNTSLESCLCSFVHLNHPLHISDPVILISLHEAVRFSFAFSFPRGTLSI      1 - 70
AYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKEL     71 - 140
PLRNLLECRFFDCMGEEDLINLGVIGTER                                             141 - 169
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.