Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Synonym

Accession P0CG43
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MGPLFTTIPGAHSGPMRPLPKKHVEPMAVRQLLLGNATMIRHTCPMSVPLSRQVKEVAAQKPSEDIYKNW      1 - 70
RRQQQQQQQQQQQQQQQQLDLLFHQRIQISLWPRKQKRRKTEQHSHSFVKKAFRFSASPGCGRPSSNKML     71 - 140
RSMGGGQRPTGLGSEFFRLLHDLHLLAFPTKCIWIHRRGEATARPRAPEHPAPPATAVRGRDAASQNLKR    141 - 210
RPGSGTDGLRLQGAEPSRLLRTYAGGAVIPTGTPERAQPPPPQDLLGRRRWLSRNTWGPWPGTTQPPSPQ    211 - 280
LLRNDWGSCGFMVPEAARGKVFQDSQEGAHIRRETVSKSVCAEPWRHQRARDPAPTNFPLKCQKQRGAST    281 - 350
SSGQHGGRVNLVFFIDSPTVIAVPDLQCPTKYSGILY                                     351 - 387
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.