Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.8e-16

Expression

Synonym

Accession P0CG42
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MGPLFTTIPGAHSGPMRPLPKKHVEPMAVRQLLLGNSTMIRHTCPMSVPLSRQVKEVAAQKPSEDIYKNR      1 - 70
QRRQQQQQQQQQQQQLDLLFHQRIQISLWPRKQKRRKTEQHSHPFVKKAFRFSAGPGCRRPSSNKMLRSM     71 - 140
GGGQRPMGLGSEFFRLLHDLHLLAFATKRIWIHRRGEATARPRAPEHPAPPATAVRGRDAASQNLKRRPG    141 - 210
SGTDGLRLQGAEPSRLLRTYAGGAVIPTGTPERAQPPPPQDPLGRRRWLSRNTWGPWPGTTQPPSPQLLR    211 - 280
NDWGSCGFMVPEAARGKVFQDSQEGAHIRRETVSKSVCAEPWRHQRARDPAPTNFPLKCQKQRGASTSSG    281 - 350
QHGGRVNLVFFIDSPTVIAVPDLQCPTKYSGILY                                        351 - 384
//

Text Mined References (2)

PMID Year Title