Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession P0CG42
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MGPLFTTIPGAHSGPMRPLPKKHVEPMAVRQLLLGNSTMIRHTCPMSVPLSRQVKEVAAQKPSEDIYKNR      1 - 70
QRRQQQQQQQQQQQQLDLLFHQRIQISLWPRKQKRRKTEQHSHPFVKKAFRFSAGPGCRRPSSNKMLRSM     71 - 140
GGGQRPMGLGSEFFRLLHDLHLLAFATKRIWIHRRGEATARPRAPEHPAPPATAVRGRDAASQNLKRRPG    141 - 210
SGTDGLRLQGAEPSRLLRTYAGGAVIPTGTPERAQPPPPQDPLGRRRWLSRNTWGPWPGTTQPPSPQLLR    211 - 280
NDWGSCGFMVPEAARGKVFQDSQEGAHIRRETVSKSVCAEPWRHQRARDPAPTNFPLKCQKQRGASTSSG    281 - 350
QHGGRVNLVFFIDSPTVIAVPDLQCPTKYSGILY                                        351 - 384
//

Text Mined References (2)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.