Property Summary

NCBI Gene PubMed Count 1
PubMed Score 96.85
PubTator Score 51.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.0e-25
Disease Target Count Z-score Confidence
Osteoarthritis 184 4.596 2.3
Prostatitis 18 3.596 1.8
Spastic hemiplegia 7 3.051 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 4.0e-25

AA Sequence

MATSILGEEPRFGTTPLAMLAATCNKIGNTSPLTTLPESSAFAKGGFHPWKRSSSSCNLGSSLSGFAVAT      1 - 70
GGRGSGGLAGGSGAANSAFCLASTSPTSSAFSSDYGGLFSNSAAAAAAAAGVSPQEAGGQSAFISKVHTT     71 - 140
AADGLYPRVGMAHPYESWYKSGFHSTLAAGEVTNGAASSWWDVHSSPGSWLEVQNPAGGLQSSLHSGAPQ    141 - 210
ASLHSQLGTYNPDFSSLTHSAFSSTGLGSSAAAASHLLSTSQHLLAQDGFKPVLPSYSDSSAAVAAAAAS    211 - 280
AMISGAAAAAAGGSSARSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLK    281 - 350
AHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHNGGGGG    351 - 420
KKGSDSDTDASNLETPRSESPDLILHDSGVSAARAAAAAAAAAAAAAAAASAGGKEAASGPNDS          421 - 484
//

Text Mined References (1)

PMID Year Title