Property Summary

NCBI Gene PubMed Count 21
PubMed Score 76.37
PubTator Score 810.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

AA Sequence

MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGP      1 - 70
EEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCR     71 - 140
CIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRE    141 - 210
RRPCGRPGLGHRL                                                             211 - 223
//

Text Mined References (22)

PMID Year Title