Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.34
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Tetralogy of Fallot 35 3.74 1.9

AA Sequence

MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGP      1 - 70
EEPLPYSWAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCR     71 - 140
CIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRE    141 - 210
RRPCGRPGLGHRL                                                             211 - 223
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.