Property Summary

NCBI Gene PubMed Count 7
PubMed Score 17.33
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia -1.500 2.7e-02
adult high grade glioma 2.700 1.5e-03
astrocytoma 1.900 4.4e-08
Astrocytoma, Pilocytic 2.600 1.1e-07
atypical teratoid / rhabdoid tumor 3.900 4.6e-05
Breast cancer 1.800 2.1e-04
ependymoma 1.700 1.8e-03
glioblastoma 3.900 1.1e-06
group 3 medulloblastoma 5.200 3.9e-09
Hydrolethalus syndrome -2.101 4.8e-02
lung adenocarcinoma -1.200 1.0e-06
lung cancer -1.400 1.3e-03
malignant mesothelioma 2.100 7.7e-08
medulloblastoma, large-cell 3.600 3.1e-04
nephrosclerosis 1.302 4.3e-02
oligodendroglioma 2.400 3.4e-09
osteosarcoma 3.300 4.4e-02
pancreatic cancer 1.100 7.8e-03
pancreatic carcinoma 1.100 7.8e-03
pituitary cancer 1.100 2.7e-02
primitive neuroectodermal tumor 5.600 4.7e-06

Gene RIF (2)

AA Sequence

MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS                               1 - 45
//

Text Mined References (9)

PMID Year Title