Property Summary

NCBI Gene PubMed Count 6
PubMed Score 18.63
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 1.34076965560568E-12
oligodendroglioma 2849 3.36697249210857E-9
atypical teratoid/rhabdoid tumor 1095 1.93112434365641E-8
astrocytoma 1493 4.35747599349915E-8
malignant mesothelioma 3163 7.68767448616463E-8
pilocytic astrocytoma 3086 2.52713398184955E-7
lung adenocarcinoma 2714 1.04839116229275E-6
pediatric high grade glioma 2712 2.58467617742733E-6
primitive neuroectodermal tumor 3031 4.6593909201154E-6
posterior fossa group A ependymoma 1511 5.58353258846761E-5
Breast cancer 3099 2.08874850572123E-4
medulloblastoma, large-cell 6234 3.13353003249914E-4
glioblastoma 5572 5.23253227813774E-4
lung cancer 4473 0.00129247161262106
pancreatic cancer 2300 0.00782460696216332
pancreatic carcinoma 567 0.0078246069621634
pituitary cancer 1972 0.0266624240279391
acute myeloid leukemia 785 0.0270955310507985
nephrosclerosis 329 0.0432437838445701
osteosarcoma 7933 0.0443853676924672
Hydrolethalus syndrome 128 0.0477421870616505
Disease Target Count Z-score Confidence
tuberculosis 1563 3.457 1.7

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis 1.302 0.043
pancreatic cancer 1.100 0.008
malignant mesothelioma 2.100 0.000
astrocytoma 1.900 0.000
glioblastoma 4.000 0.001
oligodendroglioma 2.400 0.000
osteosarcoma 3.300 0.044
posterior fossa group A ependymoma 2.300 0.000
sonic hedgehog group medulloblastoma 5.900 0.000
atypical teratoid/rhabdoid tumor 4.100 0.000
medulloblastoma, large-cell 3.600 0.000
primitive neuroectodermal tumor 5.600 0.000
Hydrolethalus syndrome -2.101 0.048
lung cancer -1.400 0.001
pediatric high grade glioma 4.000 0.000
pilocytic astrocytoma 2.600 0.000
pancreatic carcinoma 1.100 0.008
lung adenocarcinoma -1.200 0.000
acute myeloid leukemia -1.500 0.027
Breast cancer 1.800 0.000
pituitary cancer 1.100 0.027

Synonym

Accession P0CG34 A8K614 Q99406
Symbols Tbeta15b

Gene

Gene RIF (2)

PMID Text
19296525 Our data show that the TMSB15A and TMSB15B isoforms have distinct expression patterns in different tumor cell lines and tissues.
17567946 TMSL8 is well conserved in many mammalian species. Two isoforms, thymosin beta15a and b, exist at different locations, 1.4Mb apart, on human chromosome X, with 98% identity across the coding sequences.

AA Sequence

MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS                               1 - 45
//

Text Mined References (8)

PMID Year Title
19296525 2009 Differential regulation of human thymosin beta 15 isoforms by transforming growth factor beta 1.
17567946 2007 Thymosin beta-NB is the human isoform of rat thymosin beta15.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9039501 1996 Identification and cloning of neuroblastoma-specific and nerve tissue-specific genes through compiled expression profiles.