Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 3.3e-03
diabetes mellitus 1.300 2.4e-03
medulloblastoma, large-cell -1.100 1.1e-02
pituitary cancer 1.900 1.2e-05
subependymal giant cell astrocytoma -1.227 1.7e-02

AA Sequence

MASITACVGNSRQQNAPLPPWAHSMLRSLGRSLCPLVVKMAERNMKLFSGRVVPAQGKETFENWLIQVNE      1 - 70
VLPDWSMSEEEKLKRLMKTLRGPAREVMRLLQAANPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQA     71 - 140
QGEKASLYVIRLEVQLQNAIQAGILAEKDANQTRLQQLLLGAELNRDLRFRLKHLLRMYANKQERLPNFL    141 - 210
ELIKMIREEEDWDDAFIKRKRPKRSEPIMERAASPVAFQGAQPIAISSADCNCNVIEIDDTLDDSDEDVI    211 - 280
LVVSLYPSLTPTGAPPFRGRARPLDQVLVIDSPNNSGAQSLSTSGGSGYKNDGPGNIRRARKRKYTTRCS    281 - 350
YCGEEGHSKETCDNESNKAQVFENLIITLQELTHTEERSKEVPGEHSDASEPQ                     351 - 403
//

Text Mined References (4)

PMID Year Title