Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.003
medulloblastoma, large-cell -1.100 0.011
diabetes mellitus 1.300 0.002
subependymal giant cell astrocytoma -1.227 0.017
pituitary cancer 1.900 0.000

Synonym

Accession P0CG32
Symbols SIZN2
PNMA7B

Gene

PANTHER Protein Class (1)

AA Sequence

MASITACVGNSRQQNAPLPPWAHSMLRSLGRSLCPLVVKMAERNMKLFSGRVVPAQGKETFENWLIQVNE      1 - 70
VLPDWSMSEEEKLKRLMKTLRGPAREVMRLLQAANPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQA     71 - 140
QGEKASLYVIRLEVQLQNAIQAGILAEKDANQTRLQQLLLGAELNRDLRFRLKHLLRMYANKQERLPNFL    141 - 210
ELIKMIREEEDWDDAFIKRKRPKRSEPIMERAASPVAFQGAQPIAISSADCNCNVIEIDDTLDDSDEDVI    211 - 280
LVVSLYPSLTPTGAPPFRGRARPLDQVLVIDSPNNSGAQSLSTSGGSGYKNDGPGNIRRARKRKYTTRCS    281 - 350
YCGEEGHSKETCDNESNKAQVFENLIITLQELTHTEERSKEVPGEHSDASEPQ                     351 - 403
//

Text Mined References (4)

PMID Year Title
22340173 2011 Identification of proteins that interact with murine cytomegalovirus early protein M112-113 in brain.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.