Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.50

Knowledge Summary

Patent

No data available

Expression

AA Sequence

METDLAEMPEKGVLSSQDSPHFQEKSTEEGEVAALRLTARSQAAAAAAAPGSRSLRGVHVPPPLHPAPAR      1 - 70
EEIKSTCSLKACFSLSLTLTYYRTAFLLSTENEGNLHFQCPSDVETRPQSKDSTSVQDFSKAESCKVAII     71 - 140
DRLTRNSVYDSNLEAALECENWLEKQQGNQERHLREMFTHMNSLSEETDHEHDVYWKSFNQKSVLITEDR    141 - 210
VPKGSYAFHTLEKSLKQKSNLMKKQRTYKEKKPHKCNDCGELFTCHSVHIQHQRVHTGEKPYTCNECGKS    211 - 280
FSHRANLTKHQRTHTRILFECRECKKTFTESSSLATHQRIHVGERPYECNECGKGFNRSTHLVQHQLIHT    281 - 350
GVRPYECNECDKAFIHSSALIKHQRTHTGEKPYKCQECGKAFSHCSSLTKHQRVHTGEKPYECSECGKTF    351 - 420
SQSTHLVQHQRIHTGEKPYECSECGKTFSQSSNFAKHQRIHIGKKPYKCSECGKAFIHSSALIQHQRTHT    421 - 490
GEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP                                          491 - 522
//

Text Mined References (2)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.