Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
Funding $213,103.99
PubMed Score 20.50
PubTator Score 5.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Gene RIF (3)

PMID Text
22676722 Results GSTT2B insertion allele was associated with an increased risk of being small for gestational age indicate that
22216261 results suggest that the presence of the recently described GSTT2B deletion may have a protective effect on the risk of OSCC in the Mixed Ancestry South African population
19424424 study describes a previously uncharacterized 38-kilo-base (kb) long deletion polymorphism of GSTT2B located within a 61-kb DNA inverted repeat

AA Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI      1 - 70
LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMD     71 - 140
QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH    141 - 210
SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP                                        211 - 244
//

Text Mined References (16)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22676722 2012 Influence of fetal glutathione S-transferase copy number variants on adverse reproductive outcomes.
22216261 2011 Association of a deletion of GSTT2B with an altered risk of oesophageal squamous cell carcinoma in a South African population: a case-control study.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
19424424 2009 Linkage disequilibrium between two high-frequency deletion polymorphisms: implications for association studies involving the glutathione-S transferase (GST) genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
More...