Property Summary

NCBI Gene PubMed Count 40
PubMed Score 16.77
PubTator Score 25.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (23)

AA Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI      1 - 70
LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMD     71 - 140
QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH    141 - 210
SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP                                        211 - 244
//

Text Mined References (40)

PMID Year Title