Property Summary

NCBI Gene PubMed Count 40
Grant Count 4
Funding $213,103.99
PubMed Score 15.70
PubTator Score 25.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (23)

PMID Text
21598179 Polyphenol metabolites did not affect cell number but significantly upregulated GSTT2 expression and decreased COX-2.
21349909 analysis of glutathione S-transferase copy number variation alters lung gene expression
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19860743 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19696791 Observational study of gene-disease association. (HuGE Navigator)
19582785 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19528963 GSTM1 (1p13.3) and GSTT2 (22q11.23) showed a statistically significant association of non-null genotypes at both loci with an additive effect for increased vulnerability to schizophrenia
19528963 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI      1 - 70
LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPKEKVERNRTAMD     71 - 140
QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH    141 - 210
SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP                                        211 - 244
//

Text Mined References (40)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21598179 2011 Impact of polyphenol metabolites produced by colonic microbiota on expression of COX-2 and GSTT2 in human colon cells (LT97).
21349909 2011 Glutathione S-transferase copy number variation alters lung gene expression.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19860743 2010 Effect of gene-environment Interactions on mental development in African American, Dominican, and Caucasian mothers and newborns.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19696791 2009 Association between polymorphisms in glutathione S-transferase Mu3 and IgG titer levels in serum against Helicobacter pylori.
19582785 2010 Methods for detecting interactions between genetic polymorphisms and prenatal environment exposure with a mother-child design.
19528963 2010 Association of common copy number variants at the glutathione S-transferase genes and rare novel genomic changes with schizophrenia.
More...