Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 1.95

Knowledge Summary

Patent

No data available

Synonym

Accession P0CG22
Symbols SDR25C4

Gene

PANTHER Protein Class (2)

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
23036705 DHRS4L1 is a duplicate syntenic form of the human DHRS4 gene.

AA Sequence

MHKARLRGHCARAGKSVRLASSGMTRRDPLTNKVALVTASTDWIGFAVAQRLAQDGAHVVVSRRKQQNVD      1 - 70
QAVATLQGEGLSMTGTVCHVGKMKDWERLVATAMKLHGVIDILSLSITNSKRGLFWFTLLQTAEEAWDRN     71 - 140
LDINGKALALMIKAVVPEMEKRGGGSVGFLASVAAFRPLPGFSPYNVSKTALLGLNKTLAIELAPRNIRV    141 - 210
NCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDSLGIVSFLCSEDASYLTGETVMVGGGTPSR    211 - 280
L//

Text Mined References (6)

PMID Year Title
23036705 2012 Molecular and functional evolution of human DHRS2 and DHRS4 duplicated genes.
22891334 2012 AS1DHRS4, a head-to-head natural antisense transcript, silences the DHRS4 gene cluster in cis and trans.
20525226 2010 Bioinformatic analysis of the human DHRS4 gene cluster and a proposed mechanism for its transcriptional regulation.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10333503 1999 Identification of peroxisomal proteins by using M13 phage protein VI phage display: molecular evidence that mammalian peroxisomes contain a 2,4-dienoyl-CoA reductase.