Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.11
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.5e-06
lung adenocarcinoma 2716 8.0e-06
subependymal giant cell astrocytoma 2287 1.6e-02
Disease Target Count Z-score Confidence
Anorexia nervosa 80 3.629 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.300 8.0e-06
osteosarcoma 1.388 4.5e-06
subependymal giant cell astrocytoma -1.106 1.6e-02

AA Sequence

MSREAGSCRVGTGARARSRKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSLCKDSLSLLLD      1 - 70
SPDWACRRGSTTPRPHAPTPDRPGESDPGRQPQGARPTGAAPAPDLVVADIHSLHCGGGPKSRAKGSPGP     71 - 140
PPPVARATRKGPGPSGLLPESWKPGMGGDPRGVGAGDMASAGPEGSVPCYPPPAPGEFPEAHSLHLSLLG    141 - 210
VNYPLSPGLFSYLGPSLAAAAHVPFLASASPLLPPATAFPAVQPPQRPTPAPRLYYPLLLEHTLGLPAGK    211 - 280
AALAKAPVSPRSPSGTPAPGLLKVPVPGLGPWPRVTPRDPGQEGELERAAQSDPRRRLSLGSRLELPKAS    281 - 350
PSLTRFCSRSSLPTGSSVMLWPEDGDPGGPETPGPEGPLPLQPRGPVPGSPEHVGEDLTRALGDYARVEQ    351 - 420
RLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRAPAKGPQALGEAWGRPELG    421 - 490
PVLTGGTPEPPGMLGPAAPQPFSGHTTKCEADSSVPPPGLPLAAPDDPVIPGSGWGTCVATRSSQTPEAV    491 - 560
CGLQSPQGAEV                                                               561 - 571
//

Text Mined References (4)

PMID Year Title