Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 4.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.500 1.1e-03

Gene RIF (4)

AA Sequence

MKEPRIFPRERPTPWTRAPLPPRGRLDGSLGPQGGPVLNTGHPLGVNSDPFLMAAGSLGGNLTPFPRNPS      1 - 70
PFPASSGSLASNPAPFPAGARDPSMASFPRGMNPTGTGAVSFPRPGGLLGPGPGPGPTLNPRTGALPGPG     71 - 140
PLSNPRLGGLPGPGPMSNPRAGGLLGAGPDPRGGGPMGPGSGPNLRAGVLLTSGNGPPNPRPVGLGPGPN    141 - 210
PNLRSGFLGTNPAPRSGVFPGPGLGPNPRPSGLGPGPNLDARAGGLLGTGSGLNLRMAGPQGLDLAPILR    211 - 280
AAGLLGANSASFSQASGNMGTSPSSMARVPGPMGPNSGPSSRGIGLPGPNPSPMSRAPGPIGPNSAHFSR    281 - 350
PVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRATGLQ    351 - 420
GPSPTTFPRSTGPLGPGQVTFPRPAAGHLGPSPAGPVGINPAPFTRPTGTLGLNPASFPRMNGPAGKSFV    421 - 490
PFPRVGSLPGTNPAAFPRPGGPMAAMYPNGMLPP                                        491 - 524
//

Text Mined References (21)

PMID Year Title